PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.189540.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 201aa    MW: 23404.8 Da    PI: 11.1657
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.189540.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26.1e-161156147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l+++v ++G+ +W++Ia+++  gR++k+c++rw++ 
   Cucsa.189540.3 11 RGHWRPAEDTKLKELVGLYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 56
                     899*****************************.***********996 PP

2Myb_DNA-binding57.72.7e-1863107147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eE+e+l +a++++G++ W+ Iar ++ gRt++ +k++w+ +
   Cucsa.189540.3  63 RKAFTEEEEERLMQAHEMYGNK-WAMIARLFP-GRTDNGVKNHWHVV 107
                      789*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.236657IPR017930Myb domain
SMARTSM007171.7E-131059IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-2811104IPR009057Homeodomain-like
PfamPF002491.8E-151156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-261264IPR009057Homeodomain-like
CDDcd001671.66E-111455No hitNo description
PROSITE profilePS5129426.02658112IPR017930Myb domain
SMARTSM007177.6E-1462110IPR001005SANT/Myb domain
PfamPF002493.4E-1563106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2165111IPR009057Homeodomain-like
CDDcd001674.73E-1065108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MAASKSKVCG RGHWRPAEDT KLKELVGLYG PQNWNLIAEK LEGRSGKSCR LRWFNQLDPR  60
INRKAFTEEE EERLMQAHEM YGNKWAMIAR LFPGRTDNGV KNHWHVVMAR NCRQHFSSYR  120
RSSRNLTHSL SIASSALPTP PLPPTRSLSR PNHLPFHLLP RPARERVDYT FRFQHEKGLR  180
NKQRNGSYII LQLQQNELKP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32111127108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818460.0LN681846.1 Cucumis melo genomic scaffold, anchoredscaffold00009.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138987.11e-120PREDICTED: transcription factor MYB44
SwissprotQ9FDW18e-38MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A0LHV61e-120A0A0A0LHV6_CUCSA; Uncharacterized protein
STRINGPOPTR_0010s17470.12e-70(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.11e-72myb domain protein 117